PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00009488-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family SRS
Protein Properties Length: 337aa    MW: 36508.4 Da    PI: 7.2093
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00009488-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702226.26.3e-701172653154
              DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.aeaaskrkrelkskkqsalsstkls 92 
                          g++sCqdCGnqakkdC+h+RCRtCCksrg++C thvkstWvpa+krrerqqqla++++++ + + + +++kr+re+   ++s+l++t+l+
  WALNUT_00009488-RA 117 GGGISCQDCGNQAKKDCVHMRCRTCCKSRGLECPTHVKSTWVPASKRRERQQQLASMQQQHHELQlRGENPKRQREN--PTTSSLACTRLP 205
                         5789**************************************************99877765544477777777775..788999999999 PP

              DUF702  93 saeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                         ++   + le+ ++P+e++s+ vfrcvrvss+dd+++++aYqtav+igGhvfkGiLydqG+e+
  WALNUT_00009488-RA 206 TSA--SGLEVGHFPAELRSATVFRCVRVSSIDDADDQYAYQTAVNIGGHVFKGILYDQGPET 265
                         876..5689999************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.3E-66119264IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.8E-27121163IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016248.9E-28215263IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MAGFFPLGGG RSGTPSSQED HRQQSGNNPP TEIPPENLFW YKNEEVAYKQ GFELWQQQEQ  60
VLLQQQEQQQ RHQQQQLQQD LYASAAGLGV GPSRSSINVS DHDSPSRSAF MMMRSAGGGI  120
SCQDCGNQAK KDCVHMRCRT CCKSRGLECP THVKSTWVPA SKRRERQQQL ASMQQQHHEL  180
QLRGENPKRQ RENPTTSSLA CTRLPTSASG LEVGHFPAEL RSATVFRCVR VSSIDDADDQ  240
YAYQTAVNIG GHVFKGILYD QGPETNYSAA GESSSGGGGV QPLNLIASAT TASATTASGG  300
GADVGSSAMT LLDPTSLYPA PLNTFIAGTQ FFPPPRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007046785.11e-151Lateral root primordium protein-related, putative
SwissprotQ9XGX01e-101SHI_ARATH; Protein SHORT INTERNODES
TrEMBLA0A061DFV61e-151A0A061DFV6_THECC; Lateral root primordium protein-related, putative
STRINGVIT_04s0023g02780.t011e-121(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.18e-75Lateral root primordium (LRP) protein-related